PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S12978.10
Common NameJCGZ_18501, LOC105641516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YB
Protein Properties Length: 203aa    MW: 20915.1 Da    PI: 6.6792
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S12978.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.81.6e-5822117297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+kyre+egek
  Jcr4S12978.10  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKYREMEGEK 117
                    89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5617129IPR009072Histone-fold
SuperFamilySSF471131.21E-4124129IPR009072Histone-fold
PfamPF008086.0E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.3E-225573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.3E-227492No hitNo description
PRINTSPR006158.3E-2293111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MADSDNESGG HNNNANSELS AREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKIYLQKY REMEGEKSSM  120
GRQGEKDGAG GSGGGGAAAG GGGSGGGVSS SAGGGAGGGG FNGGGQGMYG GMMMMGHHQG  180
HMYGSGGYHQ QMGIGKGGSG NSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B1e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR2322760.0KR232276.1 Vernicia fordii nuclear transcription factor Y subunit B-11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081482.11e-144PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-78NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A067K1C41e-144A0A067K1C4_JATCU; Uncharacterized protein
STRINGVIT_19s0015g00440.t011e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-78nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]